SLC15A3 polyclonal antibody View larger

SLC15A3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC15A3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about SLC15A3 polyclonal antibody

Brand: Abnova
Reference: PAB24545
Product name: SLC15A3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SLC15A3.
Isotype: IgG
Gene id: 51296
Gene name: SLC15A3
Gene alias: FLJ26631|OCTP|PHT2|PTR3|hPTR3
Gene description: solute carrier family 15, member 3
Immunogen: Recombinant protein corresponding to amino acids of human SLC15A3.
Immunogen sequence/protein sequence: PMGSQVSSMLKLALQNCCPQLWQRHSARDRQCARVLADERSPQPGASPQEDIANFQ
Protein accession: Q8IY34
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB24545-48-42-1.jpg
Application image note: Immunohistochemical staining of human breast with SLC15A3 polyclonal antibody (Cat # PAB24545) shows moderate cytoplasmic and membranous positivity in glandular cells at 1:20-1:50 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy SLC15A3 polyclonal antibody now

Add to cart