DDX27 polyclonal antibody View larger

DDX27 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DDX27 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about DDX27 polyclonal antibody

Brand: Abnova
Reference: PAB24527
Product name: DDX27 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant DDX27.
Isotype: IgG
Gene id: 55661
Gene name: DDX27
Gene alias: DKFZp667N057|FLJ12917|FLJ20596|FLJ22238|HSPC259|MGC1018|MGC163147|PP3241|RHLP|Rrp3p|dJ686N3.1
Gene description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 27
Immunogen: Recombinant protein corresponding to amino acids of human DDX27.
Immunogen sequence/protein sequence: EDKEAKSGKLEKEKEAKEGSEPKEQEDLQENDEEGSEDEASETDYSSADENILTKADTLKVKDRKKKKKKGQEAGVFFEDASQYDENLSFQ
Protein accession: Q96GQ7
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB24527-48-52-1.jpg
Application image note: Immunohistochemical staining of human cerebellum with DDX27 polyclonal antibody (Cat # PAB24527) shows strong nucleolar and cytoplasmic positivity in Purkinje cells at 1:10-1:20 dilution.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy DDX27 polyclonal antibody now

Add to cart