TMC2 polyclonal antibody View larger

TMC2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TMC2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about TMC2 polyclonal antibody

Brand: Abnova
Reference: PAB24497
Product name: TMC2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant TMC2.
Isotype: IgG
Gene id: 117532
Gene name: TMC2
Gene alias: C20orf145|dJ686C3.3
Gene description: transmembrane channel-like 2
Immunogen: Recombinant protein corresponding to amino acids of human TMC2.
Immunogen sequence/protein sequence: QVLREVEKSHKSVKGKATARDSEDTPKSSSKNATQLQLTKEETTPPSASQSQAMDKKAQGPGTSNSASRT
Protein accession: Q8TDI7
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB24497-48-72-1.jpg
Application image note: Immunohistochemical staining of human skin with TMC2 polyclonal antibody (Cat # PAB24497) shows strong cytoplasmic positivity in keratinocytes at 1:200-1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy TMC2 polyclonal antibody now

Add to cart