FAM160A1 polyclonal antibody View larger

FAM160A1 polyclonal antibody

PAB24496_100uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FAM160A1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about FAM160A1 polyclonal antibody

Brand: Abnova
Reference: PAB24496
Product name: FAM160A1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant FAM160A1.
Isotype: IgG
Gene id: 729830
Gene name: FAM160A1
Gene alias: FLJ43373
Gene description: family with sequence similarity 160, member A1
Immunogen: Recombinant protein corresponding to amino acids of human FAM160A1.
Immunogen sequence/protein sequence: LLHHKPILKPLMMLLSSCSGTTTPTVEEKLVVLLNQLCSILAKDPSILELFFHTSEDQGAANFLIFS
Protein accession: Q05DH4
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB24496-48-A3-1.jpg
Application image note: Immunohistochemical staining of human stomach with FAM160A1 polyclonal antibody (Cat # PAB24496) shows distinct cytoplasmic positivity in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy FAM160A1 polyclonal antibody now

Add to cart