GNG13 polyclonal antibody View larger

GNG13 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GNG13 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about GNG13 polyclonal antibody

Brand: Abnova
Reference: PAB24491
Product name: GNG13 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant GNG13.
Isotype: IgG
Gene id: 51764
Gene name: GNG13
Gene alias: G(gamma)13|h2-35
Gene description: guanine nucleotide binding protein (G protein), gamma 13
Immunogen: Recombinant protein corresponding to amino acids of human GNG13.
Immunogen sequence/protein sequence: MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTIL
Protein accession: Q9P2W3
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB24491-48-I6-1.jpg
Application image note: Immunohistochemical staining of human duodenum with GNG13 polyclonal antibody (Cat # PAB24491) shows strong cytoplasmic positivity in fraction of glandular cells at 1:50-1:200 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy GNG13 polyclonal antibody now

Add to cart