WDR69 polyclonal antibody View larger

WDR69 polyclonal antibody

PAB24472_100uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WDR69 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about WDR69 polyclonal antibody

Brand: Abnova
Reference: PAB24472
Product name: WDR69 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant WDR69.
Isotype: IgG
Gene id: 164781
Gene name: WDR69
Gene alias: FLJ25955
Gene description: WD repeat domain 69
Immunogen: Recombinant protein corresponding to amino acids of human WDR69.
Immunogen sequence/protein sequence: GTARIFSAATRKCIAKLEGHEGEISKISFNPQGNHLLTGSSDKTARIWDAQTGQCLQVLEGHTDEIFSCAFNYKGNIVITGSKDNTCRI
Protein accession: Q8N136
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB24472-48-258-1.jpg
Application image note: Immunohistochemical staining of human rectum with WDR69 polyclonal antibody (Cat # PAB24472) shows moderate cytoplasmic and membranous positivity in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy WDR69 polyclonal antibody now

Add to cart