TIFA polyclonal antibody View larger

TIFA polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TIFA polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about TIFA polyclonal antibody

Brand: Abnova
Reference: PAB24456
Product name: TIFA polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant TIFA.
Isotype: IgG
Gene id: 92610
Gene name: TIFA
Gene alias: MGC20791|T2BP|T6BP|TIFAA
Gene description: TRAF-interacting protein with forkhead-associated domain
Immunogen: Recombinant protein corresponding to amino acids of human TIFA.
Immunogen sequence/protein sequence: FEDADTEETVTCLQMTVYHPGQLQCGIFQSISFNREKLPSSEVVKFGRNSNICHYTFQDKQVSRVQFSLQLFKKFNSSVLSFEI
Protein accession: Q96CG3
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB24456-48-A7-1.jpg
Application image note: Immunohistochemical staining of human pancreas with TIFA polyclonal antibody (Cat # PAB24456) shows strong nuclear positivity in exocrine glandular cells at 1:200-1:500 dilution.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TIFA polyclonal antibody now

Add to cart