SLC25A37 polyclonal antibody View larger

SLC25A37 polyclonal antibody

PAB24440_100uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC25A37 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about SLC25A37 polyclonal antibody

Brand: Abnova
Reference: PAB24440
Product name: SLC25A37 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SLC25A37.
Isotype: IgG
Gene id: 51312
Gene name: SLC25A37
Gene alias: HT015|MFRN|MSC|MSCP|PRO1278|PRO1584|PRO2217
Gene description: solute carrier family 25, member 37
Immunogen: Recombinant protein corresponding to amino acids of human SLC25A37.
Immunogen sequence/protein sequence: ARRMDGDSRDGGGGKDATGSEDYENLPTSASV
Protein accession: Q9NYZ2
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB24440-48-305-1.jpg
Application image note: Immunohistochemical staining of human bronchus with SLC25A37 polyclonal antibody (Cat # PAB24440) shows strong cytoplasmic, membranous and nuclear positivity in respiratory epithelial cells at 1:200-1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy SLC25A37 polyclonal antibody now

Add to cart