OR8S1 polyclonal antibody View larger

OR8S1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of OR8S1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF,WB-Tr

More info about OR8S1 polyclonal antibody

Brand: Abnova
Reference: PAB24431
Product name: OR8S1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant OR8S1.
Isotype: IgG
Gene id: 341568
Gene name: OR8S1
Gene alias: -
Gene description: olfactory receptor, family 8, subfamily S, member 1
Immunogen: Recombinant protein corresponding to amino acids of human OR8S1.
Immunogen sequence/protein sequence: ERSLRDSSHLPQLHKGQARWKRPAFTEGRREPGHPELSIPVTPQP
Protein accession: Q8NH09
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB24431-49-4-1.jpg
Application image note: Immunofluorescent staining of human cell line A-431 with OR8S1 polyclonal antibody (Cat # PAB24431) at 1-4 ug/mL dilution shows positivity in plasma membrane.
Applications: IHC-P,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy OR8S1 polyclonal antibody now

Add to cart