Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB,IHC-P |
Brand: | Abnova |
Reference: | PAB24428 |
Product name: | ZNF235 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant ZNF235. |
Isotype: | IgG |
Gene id: | 9310 |
Gene name: | ZNF235 |
Gene alias: | ANF270|HZF6|ZFP93|ZNF270 |
Gene description: | zinc finger protein 235 |
Immunogen: | Recombinant protein corresponding to amino acids of human ZNF235. |
Immunogen sequence/protein sequence: | ASVDDNCLVNHIGDHSSIIENQEFPTGKVPNSWSKIYLNETQNYQRSCKQTQMKNKLCIFAPYVDIFSCISHHH |
Protein accession: | Q14590 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (1:50-1:200) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining of human rectum with ZNF235 polyclonal antibody (Cat # PAB24428) shows moderate cytoplasmic positivity in glandular cells at 1:50-1:200 dilution. |
Applications: | WB,IHC-P |
Shipping condition: | Dry Ice |