DNTTIP2 polyclonal antibody View larger

DNTTIP2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DNTTIP2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about DNTTIP2 polyclonal antibody

Brand: Abnova
Reference: PAB24338
Product name: DNTTIP2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant DNTTIP2.
Isotype: IgG
Gene id: 30836
Gene name: DNTTIP2
Gene alias: ERBP|FCF2|HSU15552|LPTS-RP2|MGC163494|RP4-561L24.1|TdIF2
Gene description: deoxynucleotidyltransferase, terminal, interacting protein 2
Immunogen: Recombinant protein corresponding to amino acids of human DNTTIP2.
Immunogen sequence/protein sequence: PSQESHTEAISDAETSSSDISFSGIATRRTRSMQRKLKAQTEKKDSKIVPGNEKQIVGTPVNSEDSDTRQTSHLQARSLSEINKPNFYNNDFDDDFSHR
Protein accession: Q5QJE6
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB24338-49-4-1.jpg
Application image note: Immunofluorescent staining of human cell line A-431 with DNTTIP2 polyclonal antibody (Cat # PAB24338) at 1-4 ug/mL dilution shows positivity in nucleoli.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy DNTTIP2 polyclonal antibody now

Add to cart