DHX40 polyclonal antibody View larger

DHX40 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DHX40 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about DHX40 polyclonal antibody

Brand: Abnova
Reference: PAB24320
Product name: DHX40 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant DHX40.
Isotype: IgG
Gene id: 79665
Gene name: DHX40
Gene alias: ARG147|DDX40|FLJ22060|FLJ34015|PAD
Gene description: DEAH (Asp-Glu-Ala-His) box polypeptide 40
Immunogen: Recombinant protein corresponding to amino acids of human DHX40.
Immunogen sequence/protein sequence: SVGRTFCTMDGRGSPVHIHPSSALHEQETKLEWIIFHEVLVTTKVYARIVCPIRYEWVRDLLPKLHEFNAHDLSSVARREVREDARRRWTNKENVKQLKDGISKDVLKKMQRRNDDKSISDARARF
Protein accession: Q8IX18
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB24320-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with DHX40 polyclonal antibody (Cat # PAB24320) shows strong nuclear and cytoplasmic positivity in Leydig cells and moderate nuclear staining in subsets of cells in seminiferus ducts at 1:200-1:500 dilution.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy DHX40 polyclonal antibody now

Add to cart