CACNA1B polyclonal antibody View larger

CACNA1B polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CACNA1B polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about CACNA1B polyclonal antibody

Brand: Abnova
Reference: PAB24318
Product name: CACNA1B polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CACNA1B.
Isotype: IgG
Gene id: 774
Gene name: CACNA1B
Gene alias: BIII|CACNL1A5|CACNN|Cav2.2
Gene description: calcium channel, voltage-dependent, N type, alpha 1B subunit
Immunogen: Recombinant protein corresponding to amino acids of human CACNA1B.
Immunogen sequence/protein sequence: ALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGAIQNQESGIKESVSWGTQRTQDAPHE
Protein accession: Q00975
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB24318-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with CACNA1B polyclonal antibody (Cat # PAB24318) shows strong cytoplasmic positivity in cells in tubules.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy CACNA1B polyclonal antibody now

Add to cart