TSPYL2 polyclonal antibody View larger

TSPYL2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TSPYL2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about TSPYL2 polyclonal antibody

Brand: Abnova
Reference: PAB24298
Product name: TSPYL2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant TSPYL2.
Isotype: IgG
Gene id: 64061
Gene name: TSPYL2
Gene alias: CDA1|CINAP|CTCL|DENTT|HRIHFB2216|SE20-4
Gene description: TSPY-like 2
Immunogen: Recombinant protein corresponding to amino acids of human TSPYL2.
Immunogen sequence/protein sequence: NPLRYYLRERGSRIKRKKQEMKKRKTRGRCEVVIMEDAPDYYAVEDIFSEISDIDETIHDIKISDFMETTDYFETTDNEITDINENICDSENPDHNEVPNNETTDNNESADDHETTDNNESADDNNENPEDNNKNTDD
Protein accession: Q9H2G4
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:1000-1:2500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB24298-49-23-1.jpg
Application image note: Immunofluorescent staining of human cell line U-2 OS with TSPYL2 polyclonal antibody (Cat # PAB24298) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli and cytoplasm.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy TSPYL2 polyclonal antibody now

Add to cart