RHBDD3 polyclonal antibody View larger

RHBDD3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RHBDD3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about RHBDD3 polyclonal antibody

Brand: Abnova
Reference: PAB24282
Product name: RHBDD3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant RHBDD3.
Isotype: IgG
Gene id: 25807
Gene name: RHBDD3
Gene alias: C22orf3|HS984G1A|PTAG
Gene description: rhomboid domain containing 3
Immunogen: Recombinant protein corresponding to amino acids of human RHBDD3.
Immunogen sequence/protein sequence: HWEDSALPPPSLRPVQPTWEGSSEAGLDWAGASFSPGTPMWAALDEQMLQEGIQASLLDGPAQEPQSAPWLSKSSVSSL
Protein accession: Q9Y3P4
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB24282-48-A3-1.jpg
Application image note: Immunohistochemical staining of human stomach with RHBDD3 polyclonal antibody (Cat # PAB24282) shows strong cytoplasmic positivity in glandular cells at 1:200-1:500 dilution.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RHBDD3 polyclonal antibody now

Add to cart