KCNK17 polyclonal antibody View larger

KCNK17 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KCNK17 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about KCNK17 polyclonal antibody

Brand: Abnova
Reference: PAB24275
Product name: KCNK17 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant KCNK17.
Isotype: IgG
Gene id: 89822
Gene name: KCNK17
Gene alias: K2p17.1|TALK-2|TALK2|TASK-4|TASK4
Gene description: potassium channel, subfamily K, member 17
Immunogen: Recombinant protein corresponding to amino acids of human KCNK17.
Immunogen sequence/protein sequence: CSCCHHSSKEDFKSQSWRQGPDREPESHSPQQGCYPEGPMGIIQHLEPSAHAAGCGKDS
Protein accession: Q96T54
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB24275-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with KCNK17 polyclonal antibody (Cat # PAB24275) shows strong nuclear positivity in cells in seminiferus ducts.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy KCNK17 polyclonal antibody now

Add to cart