HPSE2 polyclonal antibody View larger

HPSE2 polyclonal antibody

PAB24079_100uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HPSE2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about HPSE2 polyclonal antibody

Brand: Abnova
Reference: PAB24079
Product name: HPSE2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant HPSE2.
Isotype: IgG
Gene id: 60495
Gene name: HPSE2
Gene alias: HPA2|HPR2|MGC133234
Gene description: heparanase 2
Immunogen: Recombinant protein corresponding to amino acids of human HPSE2.
Immunogen sequence/protein sequence: GKRTDFLQFQNLRNPAKSRGGPGPDYYLKNYEDDIVRSDVALDKQKGCKIAQHPDVMLELQREKAAQMHLVLLKQQFSNTY
Protein accession: Q8WWQ2
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB24079-48-41-1.jpg
Application image note: Immunohistochemical staining of human placenta with HPSE2 polyclonal antibody (Cat # PAB24079) shows strong membranous positivity in trophoblastic cells.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy HPSE2 polyclonal antibody now

Add to cart