FBRS polyclonal antibody View larger

FBRS polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FBRS polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about FBRS polyclonal antibody

Brand: Abnova
Reference: PAB24061
Product name: FBRS polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant FBRS.
Isotype: IgG
Gene id: 64319
Gene name: FBRS
Gene alias: FBS|FBS1|FLJ11618
Gene description: fibrosin
Immunogen: Recombinant protein corresponding to amino acids of human FBRS.
Immunogen sequence/protein sequence: LRHQEKMKGDSHKLDFRNDLLPCLPGPYGALPPGQELSHPASLFTATGAVHAAANPFTAAPGAHGPFLSPSTH
Protein accession: Q9HAH7
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB24061-48-A1-1.jpg
Application image note: Immunohistochemical staining of human liver with FBRS polyclonal antibody (Cat # PAB24061) shows strong cytoplasmic positivity in hepatocytes at 1:20-1:50 dilution.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy FBRS polyclonal antibody now

Add to cart