DNAJC16 polyclonal antibody View larger

DNAJC16 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DNAJC16 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about DNAJC16 polyclonal antibody

Brand: Abnova
Reference: PAB24047
Product name: DNAJC16 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant DNAJC16.
Isotype: IgG
Gene id: 23341
Gene name: DNAJC16
Gene alias: DKFZp686G1298|DKFZp686N0387|DKFZp781I1547|KIAA0962
Gene description: DnaJ (Hsp40) homolog, subfamily C, member 16
Immunogen: Recombinant protein corresponding to amino acids of human DNAJC16.
Immunogen sequence/protein sequence: TKTSLLQKFALEVYTFTGSSCLHFSFLSLDKHREWLEYLLEFAQDAAPIPNQYDKHFMERDYTGYVLALNGHKKYFCLFKPQKTVEEEEAIGSCSDVDSSLYLGESRGKPSCGLGSRPIKGKLSKLSLWMER
Protein accession: Q9Y2G8
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB24047-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with DNAJC16 polyclonal antibody (Cat # PAB24047) shows strong cytoplasmic positivity in cells in tubules at 1:50-1:200 dilution.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DNAJC16 polyclonal antibody now

Add to cart