IRGQ polyclonal antibody View larger

IRGQ polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IRGQ polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about IRGQ polyclonal antibody

Brand: Abnova
Reference: PAB24025
Product name: IRGQ polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant IRGQ.
Isotype: IgG
Gene id: 126298
Gene name: IRGQ
Gene alias: FKSG27|FLJ12521|FLJ38849|FLJ42796|FLJ46713|IRGQ1
Gene description: immunity-related GTPase family, Q
Immunogen: Recombinant protein corresponding to amino acids of human IRGQ.
Immunogen sequence/protein sequence: PPGLGKSALIAALCDKDVETLEAPEGRPDSGVPSLRAAGPGLFLGELSCPPAAPGPWAAEANVLVLVLPGPEGNGEPLAPAL
Protein accession: Q8WZA9
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB24025-48-A2-1.jpg
Application image note: Immunohistochemical staining of human colon with IRGQ polyclonal antibody (Cat # PAB24025) shows moderate cytoplasmic positivity in glandular cells.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy IRGQ polyclonal antibody now

Add to cart