TMUB2 polyclonal antibody View larger

TMUB2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TMUB2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about TMUB2 polyclonal antibody

Brand: Abnova
Reference: PAB24013
Product name: TMUB2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant TMUB2.
Isotype: IgG
Gene id: 79089
Gene name: TMUB2
Gene alias: FP2653|MGC3123
Gene description: transmembrane and ubiquitin-like domain containing 2
Immunogen: Recombinant protein corresponding to amino acids of human TMUB2.
Immunogen sequence/protein sequence: LEHLLDIQGLPKRQAGAGSSSPEAPLRSEDSTCLPPSPGLITVRLKFLNDTEELAVARPEDTVGALKSKYFPGQESQMKL
Protein accession: Q71RG4
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB24013-48-258-1.jpg
Application image note: Immunohistochemical staining of human rectum with TMUB2 polyclonal antibody (Cat # PAB24013) shows strong cytoplasmic positivity in glandular cells at 1:10-1:20 dilution.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy TMUB2 polyclonal antibody now

Add to cart