EPB41L4B polyclonal antibody View larger

EPB41L4B polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EPB41L4B polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about EPB41L4B polyclonal antibody

Brand: Abnova
Reference: PAB23993
Product name: EPB41L4B polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant EPB41L4B.
Isotype: IgG
Gene id: 54566
Gene name: EPB41L4B
Gene alias: CG1|DKFZp761N1814|EHM2|FLJ21596
Gene description: erythrocyte membrane protein band 4.1 like 4B
Immunogen: Recombinant protein corresponding to amino acids of human EPB41L4B.
Immunogen sequence/protein sequence: PLHININKAEEKKVSEKTLQTPLLPSPVADHVKCNILKAQLENASRVNIQGGKEESPFVNINKKSSLQDASVRSPIPIRVETAQPAVEKPEIKPPRVRKLTRQYSFDEDDLPP
Protein accession: Q9H329
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23993-48-I6-1.jpg
Application image note: Immunohistochemical staining of human duodenum with EPB41L4B polyclonal antibody (Cat # PAB23993) shows moderate cytoplasmic positivity in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy EPB41L4B polyclonal antibody now

Add to cart