NDUFB9 polyclonal antibody View larger

NDUFB9 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NDUFB9 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about NDUFB9 polyclonal antibody

Brand: Abnova
Reference: PAB23976
Product name: NDUFB9 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant NDUFB9.
Isotype: IgG
Gene id: 4715
Gene name: NDUFB9
Gene alias: B22|DKFZp566O173|FLJ22885|LYRM3|UQOR22
Gene description: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9, 22kDa
Immunogen: Recombinant protein corresponding to amino acids of human NDUFB9.
Immunogen sequence/protein sequence: FWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFAKREQWKKLRRESWEREVKQLQ
Protein accession: Q9Y6M9
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23976-49-4-1.jpg
Application image note: Immunofluorescent staining of human cell line A-431 with NDUFB9 polyclonal antibody (Cat # PAB23976) at 1-4 ug/mL dilution shows positivity in mitochondria.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy NDUFB9 polyclonal antibody now

Add to cart