ANKRD39 polyclonal antibody View larger

ANKRD39 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ANKRD39 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about ANKRD39 polyclonal antibody

Brand: Abnova
Reference: PAB23967
Product name: ANKRD39 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ANKRD39.
Isotype: IgG
Gene id: 51239
Gene name: ANKRD39
Gene alias: MGC41816
Gene description: ankyrin repeat domain 39
Immunogen: Recombinant protein corresponding to amino acids of human ANKRD39.
Immunogen sequence/protein sequence: RVKHLIQKAEDPSQPDSAGYTALHYASRNGHYAVCQFLLESGAKCDAQTHGGATALHRASYCGHTE
Protein accession: Q53RE8
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23967-48-A7-1.jpg
Application image note: Immunohistochemical staining of human pancreas with ANKRD39 polyclonal antibody (Cat # PAB23967) shows strong cytoplasmic positivity in exocrine glandular cells at 1:10-1:20 dilution.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ANKRD39 polyclonal antibody now

Add to cart