CENPE polyclonal antibody View larger

CENPE polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CENPE polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about CENPE polyclonal antibody

Brand: Abnova
Reference: PAB23920
Product name: CENPE polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CENPE.
Isotype: IgG
Gene id: 1062
Gene name: CENPE
Gene alias: KIF10
Gene description: centromere protein E, 312kDa
Immunogen: Recombinant protein corresponding to amino acids of human CENPE.
Immunogen sequence/protein sequence: EKIENLTRMLVTSSSLTLQQELKAKRKRRVTWCLGKINKMKNSNYADQFNIPTNITTKTHKLSINLLREIDESVCSESDVFSNTLDTLSEIEWNPATKLLNQENIESELNSLRADYDN
Protein accession: Q02224
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:1000-1:2500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23920-49-23-1.jpg
Application image note: Immunofluorescent staining of human cell line U-2 OS with CENPE polyclonal antibody (Cat # PAB23920) at 1-4 ug/mL dilution shows positivity in cytoplasm and cytoskeleton (microtubules).
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy CENPE polyclonal antibody now

Add to cart