COL4A3 polyclonal antibody View larger

COL4A3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of COL4A3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about COL4A3 polyclonal antibody

Brand: Abnova
Reference: PAB23895
Product name: COL4A3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant COL4A3.
Isotype: IgG
Gene id: 1285
Gene name: COL4A3
Gene alias: -
Gene description: collagen, type IV, alpha 3 (Goodpasture antigen)
Immunogen: Recombinant protein corresponding to amino acids of human COL4A3.
Immunogen sequence/protein sequence: KDGVPGFPGSEGVKGNRGFPGLMGEDGIKGQKGDIGPPGFRGPTEYYDTYQEKGDEGTPGPPGPRGARG
Protein accession: Q01955
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23895-48-39-1.jpg
Application image note: Immunohistochemical staining of human urinary bladder with COL4A3 polyclonal antibody (Cat # PAB23895) shows extracellular positivity at 1:50-1:200 dilution.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy COL4A3 polyclonal antibody now

Add to cart