RTTN polyclonal antibody View larger

RTTN polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RTTN polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about RTTN polyclonal antibody

Brand: Abnova
Reference: PAB23883
Product name: RTTN polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant RTTN.
Isotype: IgG
Gene id: 25914
Gene name: RTTN
Gene alias: DKFZp434G145|FLJ26356|FLJ39085
Gene description: rotatin
Immunogen: Recombinant protein corresponding to amino acids of human RTTN.
Immunogen sequence/protein sequence: SEEGADTKRPLIDARVLSRVTDLFIGKKPIELRLDDRRELVIKLETVEKVYEIFTSDDVDLVLGKSAAEQLAVIMQDIKMHAVVKKLCLIDKIIEYLNECVSQDGKVV
Protein accession: Q86VV8
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23883-48-A3-1.jpg
Application image note: Immunohistochemical staining of human stomach with RTTN polyclonal antibody (Cat # PAB23883) shows strong cytoplasmic positivity in gastric parietal cells at 1:200-1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy RTTN polyclonal antibody now

Add to cart