CLC polyclonal antibody View larger

CLC polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CLC polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about CLC polyclonal antibody

Brand: Abnova
Reference: PAB23850
Product name: CLC polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CLC.
Isotype: IgG
Gene id: 1178
Gene name: CLC
Gene alias: LGALS10|LPPL_HUMAN|MGC149659
Gene description: Charcot-Leyden crystal protein
Immunogen: Recombinant protein corresponding to amino acids of human CLC.
Immunogen sequence/protein sequence: LACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVM
Protein accession: Q05315
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:2500-1:5000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23850-48-70-1.jpg
Application image note: Immunohistochemical staining of human bone marrow with CLC polyclonal antibody (Cat # PAB23850) shows strong cytoplasmic positivity in subsets of hematopoietic cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy CLC polyclonal antibody now

Add to cart