NPVF polyclonal antibody View larger

NPVF polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NPVF polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about NPVF polyclonal antibody

Brand: Abnova
Reference: PAB23846
Product name: NPVF polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant NPVF.
Isotype: IgG
Gene id: 64111
Gene name: NPVF
Gene alias: C7orf9|RFRP
Gene description: neuropeptide VF precursor
Immunogen: Recombinant protein corresponding to amino acids of human NPVF.
Immunogen sequence/protein sequence: TANLPLRSGRNMEVSLVRRVPNLPQRFGRTTTAKSVCRMLSDLCQGSMHSPCANDLFYSMTCQHQEIQNPDQ
Protein accession: Q9HCQ7
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23846-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with NPVF polyclonal antibody (Cat # PAB23846) shows strong cytoplasmic positivity in renal tubules.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy NPVF polyclonal antibody now

Add to cart