TRAPPC2L polyclonal antibody View larger

TRAPPC2L polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TRAPPC2L polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about TRAPPC2L polyclonal antibody

Brand: Abnova
Reference: PAB23843
Product name: TRAPPC2L polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant TRAPPC2L.
Isotype: IgG
Gene id: 51693
Gene name: TRAPPC2L
Gene alias: HSPC176|MGC111156
Gene description: trafficking protein particle complex 2-like
Immunogen: Recombinant protein corresponding to amino acids of human TRAPPC2L.
Immunogen sequence/protein sequence: MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKALVDQRELYLGLLYPTEDYKVYG
Protein accession: Q9UL33
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB23843-49-4-1.jpg
Application image note: Immunofluorescent staining of human cell line A-431 with TRAPPC2L polyclonal antibody (Cat # PAB23843) at 1-4 ug/mL dilution shows positivity in cytoplasm.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy TRAPPC2L polyclonal antibody now

Add to cart