ARHGAP17 polyclonal antibody View larger

ARHGAP17 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARHGAP17 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about ARHGAP17 polyclonal antibody

Brand: Abnova
Reference: PAB23842
Product name: ARHGAP17 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ARHGAP17.
Isotype: IgG
Gene id: 55114
Gene name: ARHGAP17
Gene alias: DKFZp564A1363|FLJ37567|FLJ43368|MGC87805|MST066|MST110|MSTP038|MSTP066|MSTP110|NADRIN|RICH1|WBP15
Gene description: Rho GTPase activating protein 17
Immunogen: Recombinant protein corresponding to amino acids of human ARHGAP17.
Immunogen sequence/protein sequence: KQLARLVLDWDSVRARWNQAHKSSGTNFQGLPSKIDTLKEEMDEAGNKVEQCKDQLAADMYNFMAKEGEYGKFFVTLLEA
Protein accession: Q68EM7
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23842-48-41-1.jpg
Application image note: Immunohistochemical staining of human placenta with ARHGAP17 polyclonal antibody (Cat # PAB23842) shows moderate cytoplasmic positivity in trophoblastic cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy ARHGAP17 polyclonal antibody now

Add to cart