ANO3 polyclonal antibody View larger

ANO3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ANO3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about ANO3 polyclonal antibody

Brand: Abnova
Reference: PAB23833
Product name: ANO3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ANO3.
Isotype: IgG
Gene id: 63982
Gene name: ANO3
Gene alias: C11orf25|GENX-3947|TMEM16C
Gene description: anoctamin 3
Immunogen: Recombinant protein corresponding to amino acids of human ANO3.
Immunogen sequence/protein sequence: DKRNTFEKNLRAEGLMLEKEPAIASPDIMFIKIHIPWDTLCKYAERLNIRMPFRKKCYYTDGRSKSMGRMQTYFRRIKNWMAQNPM
Protein accession: Q9BYT9
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23833-48-305-1.jpg
Application image note: Immunohistochemical staining of human bronchus with ANO3 polyclonal antibody (Cat # PAB23833) shows strong cytoplasmic and membranous positivity in respiratory epithelial cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy ANO3 polyclonal antibody now

Add to cart