SLC7A6OS polyclonal antibody View larger

SLC7A6OS polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC7A6OS polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about SLC7A6OS polyclonal antibody

Brand: Abnova
Reference: PAB23823
Product name: SLC7A6OS polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SLC7A6OS.
Isotype: IgG
Gene id: 84138
Gene name: SLC7A6OS
Gene alias: FLJ13291
Gene description: solute carrier family 7, member 6 opposite strand
Immunogen: Recombinant protein corresponding to amino acids of human SLC7A6OS.
Immunogen sequence/protein sequence: AEALVLACKRLRSDAVESAAQKTSEGLERAAENNVFHLVATVCSQEEPVQPLLREVLRPSRDSQQRVRRNLRASAREVRQEGRYRVLS
Protein accession: Q96CW6
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23823-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with SLC7A6OS polyclonal antibody (Cat # PAB23823) shows strong nuclear positivity in cells in seminiferus tubules.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy SLC7A6OS polyclonal antibody now

Add to cart