Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Clonality | Polyclonal |
Host species | Rabbit |
Applications | IHC-P |
Product description: | Rabbit polyclonal antibody raised against recombinant CCDC135. |
Isotype: | IgG |
Gene id: | 84229 |
Gene name: | CCDC135 |
Gene alias: | C16orf50|DKFZp434I099 |
Gene description: | coiled-coil domain containing 135 |
Immunogen: | Recombinant protein corresponding to amino acids of human CCDC135. |
Immunogen sequence/protein sequence: | VPENFFIDPFTGHSYSTQDEHFLGIESLWNHKNYWINMQDCWNCCKDLIFDLGDPVRWEYMLLGTDKSQLSLTEEDDSGINDEDDVENLGKE |
Protein accession: | Q8IY82 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (1:20-1:50) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Size: | 100 uL |
Shipping condition: | Dry Ice |