TELO2 polyclonal antibody View larger

TELO2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TELO2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about TELO2 polyclonal antibody

Brand: Abnova
Reference: PAB23808
Product name: TELO2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant TELO2.
Isotype: IgG
Gene id: 9894
Gene name: TELO2
Gene alias: CLK2|DKFZp434A073|FLJ10924|KIAA0683|TEL2|c305C8.3|hCLK2
Gene description: TEL2, telomere maintenance 2, homolog (S. cerevisiae)
Immunogen: Recombinant protein corresponding to amino acids of human TELO2.
Immunogen sequence/protein sequence: SKAVLICLAQLGEPELRDSRDELLASMMAGVKCRLDSSLPPVRRLGMIVAEVVSARIHPEGPPLKFQYEEDELSLELLALASPQPAGDGASEAGTSLVPATA
Protein accession: Q9Y4R8
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23808-49-187-1.jpg
Application image note: Immunofluorescent staining of human cell line U-251 MG with TELO2 polyclonal antibody (Cat # PAB23808) at 1-4 ug/mL dilution shows positivity in nucleus and cytoplasm.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy TELO2 polyclonal antibody now

Add to cart