Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PLEKHG6 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB,IHC-P |
More info about PLEKHG6 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB23806 |
| Product name: | PLEKHG6 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant PLEKHG6. |
| Isotype: | IgG |
| Gene id: | 55200 |
| Gene name: | PLEKHG6 |
| Gene alias: | FLJ10665|MGC126315|MGC126353|MGC126354|MyoGEF |
| Gene description: | pleckstrin homology domain containing, family G (with RhoGef domain) member 6 |
| Immunogen: | Recombinant protein corresponding to amino acids of human PLEKHG6. |
| Immunogen sequence/protein sequence: | GLLMEVSAETLFGNVPSLIRTHRSFWDEVLGPTLEETRASGQPLDPIGLQSGFLTFGQRFHPYVQYCLRVKQTMAYAREQQETNPLFHAFVQWCE |
| Protein accession: | Q3KR16 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:10-1:20) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining of human placenta with PLEKHG6 polyclonal antibody (Cat # PAB23806) shows strong membranous staining positivity in trophoblastic cells. |
| Applications: | WB,IHC-P |
| Shipping condition: | Dry Ice |