Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Clonality | Polyclonal |
Host species | Rabbit |
Applications | IHC-P |
Reference: | PAB23803 |
Product name: | LHFPL4 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant LHFPL4. |
Isotype: | IgG |
Gene id: | 375323 |
Gene name: | LHFPL4 |
Gene alias: | MGC133162 |
Gene description: | lipoma HMGIC fusion partner-like 4 |
Immunogen: | Recombinant protein corresponding to amino acids of human LHFPL4. |
Immunogen sequence/protein sequence: | FVLGNRQTDLLQEELKPENKDFVGSTVSSVLRPGGDVSGWGVLPCPVAHSQG |
Protein accession: | Q7Z7J7 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Shipping condition: | Dry Ice |