DHX38 polyclonal antibody View larger

DHX38 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DHX38 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB,IHC-P

More info about DHX38 polyclonal antibody

Brand: Abnova
Reference: PAB23787
Product name: DHX38 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant DHX38.
Isotype: IgG
Gene id: 9785
Gene name: DHX38
Gene alias: DDX38|KIAA0224|PRP16|PRPF16
Gene description: DEAH (Asp-Glu-Ala-His) box polypeptide 38
Immunogen: Recombinant protein corresponding to amino acids of human DHX38.
Immunogen sequence/protein sequence: MDEGYDEFHNPLAYSSEDYVRRREQHLHKQKQKRISAQRRQINEDNERWETNRMLTSGVVHRLEVDEDFEEDNAAKVHLMVHNLVPPFLDGRIVFTKQPE
Protein accession: Q92620
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB23787-48-35-1.jpg
Application image note: Immunohistochemical staining of human esophagus with DHX38 polyclonal antibody (Cat # PAB23787) shows strong cytoplasmic and nuclear positivity in squamous epithelial cells at 1:50-1:200 dilution.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy DHX38 polyclonal antibody now

Add to cart