CORO2A polyclonal antibody View larger

CORO2A polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CORO2A polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about CORO2A polyclonal antibody

Brand: Abnova
Reference: PAB23778
Product name: CORO2A polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CORO2A.
Isotype: IgG
Gene id: 7464
Gene name: CORO2A
Gene alias: CLIPINB|DKFZp686G19226|IR10|WDR2
Gene description: coronin, actin binding protein, 2A
Immunogen: Recombinant protein corresponding to amino acids of human CORO2A.
Immunogen sequence/protein sequence: WRSSSLLEEKMPRWAAEHRLEEKKTWLTNGFDVFECPPPKTENELLQMFYRQQEEIRRLRELLTQREVQAKQ
Protein accession: Q92828
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23778-48-A3-1.jpg
Application image note: Immunohistochemical staining of human stomach with CORO2A polyclonal antibody (Cat # PAB23778) shows cytoplasmic and moderate membranous positivity in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy CORO2A polyclonal antibody now

Add to cart