OAS3 polyclonal antibody View larger

OAS3 polyclonal antibody

PAB23774_100uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of OAS3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about OAS3 polyclonal antibody

Brand: Abnova
Reference: PAB23774
Product name: OAS3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant OAS3.
Isotype: IgG
Gene id: 4940
Gene name: OAS3
Gene alias: MGC133260|p100
Gene description: 2'-5'-oligoadenylate synthetase 3, 100kDa
Immunogen: Recombinant protein corresponding to amino acids of human OAS3.
Immunogen sequence/protein sequence: LKGGCDSELVIFLDCFKSYVDQRARRAEILSEMRASLESWWQNPVPGLRLTFPEQSVPGALQFRLTSVDLEDWMDVSLVPAFNVLGQAGSGVKPKPQV
Protein accession: Q9Y6K5
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23774-48-42-1.jpg
Application image note: Immunohistochemical staining of human breast with OAS3 polyclonal antibody (Cat # PAB23774) shows moderate cytoplasmic positivity in glandular cells at 1:500-1:1000 dilution.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy OAS3 polyclonal antibody now

Add to cart