LSM4 polyclonal antibody View larger

LSM4 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LSM4 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about LSM4 polyclonal antibody

Brand: Abnova
Reference: PAB23720
Product name: LSM4 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant LSM4.
Isotype: IgG
Gene id: 25804
Gene name: LSM4
Gene alias: YER112W
Gene description: LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Immunogen: Recombinant protein corresponding to amino acids of human LSM4.
Immunogen sequence/protein sequence: MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIID
Protein accession: Q9Y4Z0
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23720-48-53-1.jpg
Application image note: Immunohistochemical staining of human lateral ventricle with LSM4 polyclonal antibody (Cat # PAB23720) shows strong cytoplasmic positivity, with a granular pattern in neuronal cells at 1:200-1:500 dilution.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LSM4 polyclonal antibody now

Add to cart