C18orf32 polyclonal antibody View larger

C18orf32 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C18orf32 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about C18orf32 polyclonal antibody

Brand: Abnova
Reference: PAB23717
Product name: C18orf32 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant C18orf32.
Isotype: IgG
Gene id: 497661
Gene name: C18orf32
Gene alias: FLJ23458
Gene description: chromosome 18 open reading frame 32
Immunogen: Recombinant protein corresponding to amino acids of human C18orf32.
Immunogen sequence/protein sequence: PFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDK
Protein accession: Q8TCD1
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23717-48-52-1.jpg
Application image note: Immunohistochemical staining of human cerebellum with C18orf32 polyclonal antibody (Cat # PAB23717) shows strong cytoplasmic and nuclear positivity in purkinje cells at 1:20-1:50 dilution.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy C18orf32 polyclonal antibody now

Add to cart