SEC31B polyclonal antibody View larger

SEC31B polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SEC31B polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about SEC31B polyclonal antibody

Brand: Abnova
Reference: PAB23700
Product name: SEC31B polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SEC31B.
Isotype: IgG
Gene id: 25956
Gene name: SEC31B
Gene alias: DKFZp434M183|SEC31B-1|SEC31L2
Gene description: SEC31 homolog B (S. cerevisiae)
Immunogen: Recombinant protein corresponding to amino acids of human SEC31B.
Immunogen sequence/protein sequence: ATWLKSDVGLGESPQPKGNDLNSDRQQAFCSQASKHTTKEASASSAFFDELVPQNMTPWEIPITKDIDGLLSQALLLGELG
Protein accession: Q9NQW1
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23700-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with SEC31B polyclonal antibody (Cat # PAB23700) shows strong cytoplasmic positivity in cells in seminiferus ducts at 1:200-1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy SEC31B polyclonal antibody now

Add to cart