PPTC7 polyclonal antibody View larger

PPTC7 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PPTC7 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about PPTC7 polyclonal antibody

Brand: Abnova
Reference: PAB23673
Product name: PPTC7 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant PPTC7.
Isotype: IgG
Gene id: 160760
Gene name: PPTC7
Gene alias: DKFZp686M07120|MGC133072|TA-PP2C|TAPP2C
Gene description: PTC7 protein phosphatase homolog (S. cerevisiae)
Immunogen: Recombinant protein corresponding to amino acids of human PPTC7.
Immunogen sequence/protein sequence: LGDIILTATDGLFDNMPDYMILQELKKLKNSNYESIQQTARSIAEQAHELAYDPNYMSPFAQFACDNGLNVRGGKPDDITVLLSIVAEY
Protein accession: Q8NI37
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23673-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with PPTC7 polyclonal antibody (Cat # PAB23673) shows strong cytoplasmic positivity in cells in tubules.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy PPTC7 polyclonal antibody now

Add to cart