CNNM1 polyclonal antibody View larger

CNNM1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CNNM1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about CNNM1 polyclonal antibody

Brand: Abnova
Reference: PAB23655
Product name: CNNM1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CNNM1.
Isotype: IgG
Gene id: 26507
Gene name: CNNM1
Gene alias: ACDP1|FLJ31632
Gene description: cyclin M1
Immunogen: Recombinant protein corresponding to amino acids of human CNNM1.
Immunogen sequence/protein sequence: TACHMDSSPQSPDMEAFTDGDSTKAPTTRGTPQTPKDDPAITLLNNRNSLPCSRSDGLRSPSEVVYLRMEELAFTQEEMTDFEEHSTQQLT
Protein accession: Q9NRU3
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:1000-1:2500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23655-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with CNNM1 polyclonal antibody (Cat # PAB23655) shows moderate cytoplasmic positivity in cells in seminiferus ducts and strong positivity in Leydig cells.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy CNNM1 polyclonal antibody now

Add to cart