PIGN polyclonal antibody View larger

PIGN polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PIGN polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about PIGN polyclonal antibody

Brand: Abnova
Reference: PAB23650
Product name: PIGN polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant PIGN.
Isotype: IgG
Gene id: 23556
Gene name: PIGN
Gene alias: MCD4|MDC4|MGC26427|PIG-N
Gene description: phosphatidylinositol glycan anchor biosynthesis, class N
Immunogen: Recombinant protein corresponding to amino acids of human PIGN.
Immunogen sequence/protein sequence: KVDDGVKEIVSMFNHFYGNDGKTTFIFTSDHGMTDWGSHGAGHPSETLTPLVTWGAGIKYPQRVSAQQFDDAFLKEWRLENWK
Protein accession: O95427
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23650-48-A3-1.jpg
Application image note: Immunohistochemical staining of human stomach with PIGN polyclonal antibody (Cat # PAB23650) shows strong cytoplasmic positivity in glandular cells at 1:200-1:500 dilution.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PIGN polyclonal antibody now

Add to cart