C12orf34 polyclonal antibody View larger

C12orf34 polyclonal antibody

PAB23628_100uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C12orf34 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about C12orf34 polyclonal antibody

Brand: Abnova
Reference: PAB23628
Product name: C12orf34 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant C12orf34.
Isotype: IgG
Gene id: 84915
Gene name: C12orf34
Gene alias: FLJ14721
Gene description: chromosome 12 open reading frame 34
Immunogen: Recombinant protein corresponding to amino acids of human C12orf34.
Immunogen sequence/protein sequence: PSIHSLLYQLNQQCQAPGAAPPACQGMAIPHPSPAKHGPVPSFPSMAYSAAAGLPDCRKGTELGQGATQALTLAGAAKPAGYADSGLDYLLWPQKP
Protein accession: Q5U5X8
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23628-48-A3-1.jpg
Application image note: Immunohistochemical staining of human stomach with C12orf34 polyclonal antibody (Cat # PAB23628) shows strong cytoplasmic positivity in glandular cells at 1:200-1:500 dilution.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy C12orf34 polyclonal antibody now

Add to cart