NLRP10 polyclonal antibody View larger

NLRP10 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NLRP10 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about NLRP10 polyclonal antibody

Brand: Abnova
Reference: PAB23622
Product name: NLRP10 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant NLRP10.
Isotype: IgG
Gene id: 338322
Gene name: NLRP10
Gene alias: CLR11.1|NALP10|NOD8|PAN5|PYNOD
Gene description: NLR family, pyrin domain containing 10
Immunogen: Recombinant protein corresponding to amino acids of human NLRP10.
Immunogen sequence/protein sequence: RARYFSSYFTDEKQADRAFDIVQKNDILYKACQVPGICWVVCSWLQGQMERGKVVLETPRNSTDIFMAYVSTFLPPDDDGGCSELSRHRV
Protein accession: Q86W26
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23622-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with NLRP10 polyclonal antibody (Cat # PAB23622) shows strong cytoplasmic positivity in tubular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy NLRP10 polyclonal antibody now

Add to cart