AP4S1 polyclonal antibody View larger

AP4S1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AP4S1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about AP4S1 polyclonal antibody

Brand: Abnova
Reference: PAB23605
Product name: AP4S1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant AP4S1.
Isotype: IgG
Gene id: 11154
Gene name: AP4S1
Gene alias: AP47B|CLA20|CLAPS4|FLJ32366
Gene description: adaptor-related protein complex 4, sigma 1 subunit
Immunogen: Recombinant protein corresponding to amino acids of human AP4S1.
Immunogen sequence/protein sequence: LDEYFSRVSELDVSFFNTVFHSTWQMHSGPYQEPIDELPKICSALEPQQTCFSPDSSSFKGAASTT
Protein accession: Q9Y587
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23605-48-258-1.jpg
Application image note: Immunohistochemical staining of human rectum with AP4S1 polyclonal antibody (Cat # PAB23605) shows strong cytoplasmic positivity in glandular cells at 1:50-1:200 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy AP4S1 polyclonal antibody now

Add to cart