MED19 polyclonal antibody View larger

MED19 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MED19 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF,WB-Tr

More info about MED19 polyclonal antibody

Brand: Abnova
Reference: PAB23597
Product name: MED19 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant MED19.
Isotype: IgG
Gene id: 219541
Gene name: MED19
Gene alias: DT2P1G7|LCMR1
Gene description: mediator complex subunit 19
Immunogen: Recombinant protein corresponding to amino acids of human MED19.
Immunogen sequence/protein sequence: GSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPV
Protein accession: A0JLT2
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23597-49-187-1.jpg
Application image note: Immunofluorescent staining of human cell line U-251 MG with MED19 polyclonal antibody (Cat # PAB23597) at 1-4 ug/mL dilution shows positivity in nucleus.
Applications: IHC-P,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MED19 polyclonal antibody now

Add to cart